| ID | DRAMP00004 |
|---|---|
| Sequence | MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK |
| Length | 46 |
| Name | Lantibiotic (Bacteriocin) |
| Source | Streptococcus pyogenes serotype M28 (strain MGAS6180) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q48TR2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16088825 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK |
| Molecular Weight | 5218.999 |
| Grand Average of Hydropathy | -0.391 |
| Isoelectric Point | 8.931 |
| Charge at pH 7.4 | 2.193 |
| Secondary Structure | Helix: 0.283, Turn: 0.196, Sheet: 0.130 |
| Instability Index | 21.454 |
| Aromaticity | 0.109 |