Basic Information
| ID | DRAMP00014 |
|---|
| Sequence | VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC |
|---|
| Length | 33 |
|---|
| Name | Geobacillin I (nisin analog; Bacteriocin) |
|---|
| Source | Geobacillus thermodenitrificans NG80-2 (Gram-positive bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
|---|
| Pathogen | Gram-positive bacteria: Streptococcus dysgalatiae subsp dysgalactiae ATCC 27957 (IC50=0.69±0.05 µM), Vancomycin-resistant Enterococcusfaecium CNRZ 481 (IC50=0.84±0.05 µM), Methicillin-resistant Staphylococcus aureus C5 (IC50=2.23±0.03 µM), Bacillus anthracis Sterne 7702 (IC50=0.49±0.02 µM), Bacillus subtilis ATCC 6633 (IC50=0.55±0.01 µM), Lactococcus lactis HP ATCC 11602 (IC50=0.12±0.09 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization between S29 and C33 |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 22431611 |
|---|
