| ID | DRAMP00022 |
|---|---|
| Sequence | CSTNTFSLSDYWGNKGNWCTATHECMSWCK |
| Length | 30 |
| Name | Staphylococcin C55alpha (SacAalpha; chain alpha of Staphylococcin C55; Bacteriocin) |
| Source | Staphylococcus aureus C55 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus and Micrococcus luteus (C55alpha and C55beta work synergistically at a ratio of 1:1). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9835565, 10417203 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | CSTNTFSLSDYWGNKGNWCTATHECMSWCK |
| Molecular Weight | 3461.816 |
| Grand Average of Hydropathy | -0.633 |
| Isoelectric Point | 6.716 |
| Charge at pH 7.4 | -0.51 |
| Secondary Structure | Helix: 0.200, Turn: 0.300, Sheet: 0.133 |
| Instability Index | 46 |
| Aromaticity | 0.167 |