Basic Information
| ID | DRAMP00071 |
|---|
| Sequence | KTVNYGNGLYCNQKKCWVNWSETATTIVNNSIMNGLTGGNAGWHSGGRA |
|---|
| Length | 49 |
|---|
| Name | Ubericin-A (Bacteriocin) |
|---|
| Source | Streptococcus uberis (Gram-positive bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
|---|
| Pathogen | Gram-positive bacteria: Listeria spp., Enterococcus hirae, Enterococcus faecalis ATCC 19433, Streptococcus bovis 83, Streptococcus uberis 42 and Lactococcus lactis. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
A9Q0M7 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 17933926 |
|---|
