| ID | DRAMP00103 |
|---|---|
| Sequence | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTFH |
| Length | 54 |
| Name | Bacteriocin OR-7 (Preclinical) |
| Source | Lactobacillus salivarius NRRL B-30514 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Campylobacter jejuni NCTC 11168. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16940109 |
Physicochemical Properties
| Residues | 54 |
|---|---|
| Sequence | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTFH |
| Molecular Weight | 6215.065 |
| Grand Average of Hydropathy | -0.646 |
| Isoelectric Point | 9.845 |
| Charge at pH 7.4 | 5.582 |
| Secondary Structure | Helix: 0.296, Turn: 0.222, Sheet: 0.167 |
| Instability Index | 28.365 |
| Aromaticity | 0.148 |