| ID | DRAMP00113 |
|---|---|
| Sequence | TTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGAIPGKC |
| Length | 47 |
| Name | Enterocin A (EntA; Pediocin-like peptide; Bacteriocin) |
| Source | Enterococcus faecium (Streptococcus faecium) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8633865 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | TTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGAIPGKC |
| Molecular Weight | 4832.538 |
| Grand Average of Hydropathy | -0.03 |
| Isoelectric Point | 9.071 |
| Charge at pH 7.4 | 3.127 |
| Secondary Structure | Helix: 0.234, Turn: 0.298, Sheet: 0.128 |
| Instability Index | 25.081 |
| Aromaticity | 0.106 |