| ID | DRAMP00179 |
|---|---|
| Sequence | MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC |
| Length | 34 |
| Name | Enterocin Q (EntQ; Bacteriocin) |
| Source | Enterococcus faecium L50 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | A broad antimicrobial spectrum against the most relevant beer-spoilage lactic acid bacteria (LAB) (i.e., Lactobacillus brevis and Pediococcus damnosus). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q7WYZ9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11073927, 17021217 |
Physicochemical Properties
| Residues | 34 |
|---|---|
| Sequence | MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC |
| Molecular Weight | 3951.701 |
| Grand Average of Hydropathy | -0.359 |
| Isoelectric Point | 9.392 |
| Charge at pH 7.4 | 3.218 |
| Secondary Structure | Helix: 0.294, Turn: 0.206, Sheet: 0.294 |
| Instability Index | 21.659 |
| Aromaticity | 0.147 |