| ID | DRAMP00196 |
|---|---|
| Sequence | GDVNWVDVGKTVATNGAGVIGGAFGAGLCGPVCAGAFAVGSSAAVAALYDAAGNSNSAKQKPEGLPPEAWNYAEGRMCNWSPNNLSDVCL |
| Length | 90 |
| Name | Microcin L (MccL; Bacteriocin) |
| Source | Escherichia coli (Gram-negative bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Escherichia coli, Klebsiella oxytoca CIP666, Salmonella enterica serovar Agon, S. enterica serovar Braenderup, S. enterica serovar Brandenburg, S. enterica serovar Bredeney, S. enterica serovar Derby, S. enterica serovar Dublin, S. enterica serovar Enteritidis ATCC 13076, S. enterica serovar Hadar, S. enterica serovar Heildeberg, S. enterica serovar Indiana, S. enterica serovar Kottbus, S. enterica serovar Newport, S. enterica serovar St.Paul, S. enterica serovar Typhimurium CIP5858, S. enterica serovar Virchow, Shigella sonnei CIP5236, Shigella flexneri CIP5236, Pseudomonas aeruginosa CIP100720T, Pseudomonas aeruginosa ATCC 27853. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q841V4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 14742202, 12897830 |
Physicochemical Properties
| Residues | 90 |
|---|---|
| Sequence | GDVNWVDVGKTVATNGAGVIGGAFGAGLCGPVCAGAFAVGSSAAVAALYDAAGNSNSAKQKPEGLPPEAWNYAEGRMCNWSPNNLSDVCL |
| Molecular Weight | 8887.788 |
| Grand Average of Hydropathy | 0.114 |
| Isoelectric Point | 4.386 |
| Charge at pH 7.4 | -3.548 |
| Secondary Structure | Helix: 0.244, Turn: 0.367, Sheet: 0.278 |
| Instability Index | 23.322 |
| Aromaticity | 0.078 |