| ID | DRAMP00199 |
|---|---|
| Sequence | MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYSMSSSTSSANSGS |
| Length | 62 |
| Name | Microcin I47 (MccI47; Bacteriocin) |
| Source | Escherichia coli H47 (Gram-negative bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16569859 |
Physicochemical Properties
| Residues | 62 |
|---|---|
| Sequence | MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYSMSSSTSSANSGS |
| Molecular Weight | 6274.846 |
| Grand Average of Hydropathy | -0.252 |
| Isoelectric Point | 4.139 |
| Charge at pH 7.4 | -2.748 |
| Secondary Structure | Helix: 0.194, Turn: 0.484, Sheet: 0.194 |
| Instability Index | 44.776 |
| Aromaticity | 0.065 |