| ID | DRAMP00200 |
|---|---|
| Sequence | DGNDGQAELIAIGSLAGTFISPGFGSIAGAYIGDKVHSWATTATVSPSMSPSGIGLSSQFGSGRGTSSASSSAGSGS |
| Length | 77 |
| Name | Microcin M (MccM; Bacteriocin) |
| Source | Escherichia coli MC4100 (Gram-negative bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 77 |
|---|---|
| Sequence | DGNDGQAELIAIGSLAGTFISPGFGSIAGAYIGDKVHSWATTATVSPSMSPSGIGLSSQFGSGRGTSSASSSAGSGS |
| Molecular Weight | 7282.758 |
| Grand Average of Hydropathy | 0.082 |
| Isoelectric Point | 4.659 |
| Charge at pH 7.4 | -2.408 |
| Secondary Structure | Helix: 0.208, Turn: 0.481, Sheet: 0.182 |
| Instability Index | 40.056 |
| Aromaticity | 0.065 |
