| ID | DRAMP00215 |
|---|---|
| Sequence | NRWYCNSAAGGVGGAAGCVLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG |
| Length | 62 |
| Name | Enterocin E-760 (Bacteriocin) |
| Source | Enterococcus durans/faecium/hirae NRRL B-30745 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Salmonella enterica serovar Enteritidis, S. enterica serovar Choleraesuis, S. enterica serovar Typhimurium, S. enterica serovar Gallinarum, Escherichia coli O157:H7, Yersinia enterocolitica, Citrobacter freundii, Klebsiella pneumoniae, Shigella dysenteriae, Pseudomonas aeruginosa, Proteus mirabilis, Morganella morganii, Staphylococcus aureus, Staphylococcus epidermidis, Listeria monocytogenes, Campylobacter jejuni, 20 other Campylobacter species isolates. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18086839 |
Physicochemical Properties
| Residues | 62 |
|---|---|
| Sequence | NRWYCNSAAGGVGGAAGCVLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG |
| Molecular Weight | 6179.832 |
| Grand Average of Hydropathy | -0.177 |
| Isoelectric Point | 8.995 |
| Charge at pH 7.4 | 2.509 |
| Secondary Structure | Helix: 0.210, Turn: 0.387, Sheet: 0.242 |
| Instability Index | 41.347 |
| Aromaticity | 0.113 |