| ID | DRAMP00216 |
|---|---|
| Sequence | AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK |
| Length | 47 |
| Name | Antimicrobial peptide LCI (Bacteriocin) |
| Source | Bacillus subtilis (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | X. oryzae pv oryzae, R. solanacearum. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P82243 |
| PDB | 2B9K |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available, 21449609 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK |
| Molecular Weight | 5464.146 |
| Grand Average of Hydropathy | -0.351 |
| Isoelectric Point | 9.401 |
| Charge at pH 7.4 | 2.585 |
| Secondary Structure | Helix: 0.404, Turn: 0.255, Sheet: 0.128 |
| Instability Index | 13.079 |
| Aromaticity | 0.213 |