Basic Information
| ID | DRAMP00222 |
|---|
| Sequence | GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVFIPVLIGPSWNGSGSGYNSATSSSGSGS |
|---|
| Length | 84 |
|---|
| Name | Microcin E492 (MccE492; Bacteriocin) |
|---|
| Source | Klebsiella pneumoniae RYC492 (Gram-negative bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli F (MIC=0.14 µM), Escherichia coli 363 (MIC=0.02 µM), Escherichia coli ML35p (MIC=0.14 µM), Escherichia coli GM1 (MIC=0.04 µM), Escherichia coli GM1 KP1060(MIC=0.65 µM), Escherichia coli W3110 (MIC=0.02 µM), Escherichia coli W3110-KP1344 Pms7 (MIC=0.08 µM), Escherichia coli W3110-6 (MIC=0.32 µM), Escherichia coli C600 (MIC=0.08 µM), Escherichia coli C600 pHX405 (MIC=0.16 µM), Salmonella enteritidis (MIC=0.6 µM), Salmonella typhimurium (MIC=1.2 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Attachment to a siderophore ester |
|---|
| Linear/Cyclic/Branched | Linear |
|---|
| Uniprot |
Q9Z4N4 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 12890026, 15102848, 7682973 |
|---|
