| ID | DRAMP00252 |
|---|---|
| Sequence | VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR |
| Length | 51 |
| Name | AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin) |
| Source | Anaeromyxobacter dehalogenans (Gram-negative bacteria) |
| Activity | Antibacterial, Antifungal, Antiparasitic, Antimicrobial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19615342 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR |
| Molecular Weight | 5431.171 |
| Grand Average of Hydropathy | -0.325 |
| Isoelectric Point | 5.644 |
| Charge at pH 7.4 | -1.537 |
| Secondary Structure | Helix: 0.176, Turn: 0.275, Sheet: 0.294 |
| Instability Index | 30.192 |
| Aromaticity | 0.02 |