| ID | DRAMP00253 |
|---|---|
| Sequence | DAPGHPGKHYLQVNVPSDVRTIGVAGGGVQQCFRVTPGAWNDTRALVSNGAQVEVWGYTVADCANRTTANQKYYDKAAAPSDSSTYFWFTLKNLRV |
| Length | 96 |
| Name | Ipomicin (Bacteriocin) |
| Source | sweet potato pathogen); also Streptomyces ipomoeae (Gram-negative bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12676701 |
Physicochemical Properties
| Residues | 96 |
|---|---|
| Sequence | DAPGHPGKHYLQVNVPSDVRTIGVAGGGVQQCFRVTPGAWNDTRALVSNGAQVEVWGYTVADCANRTTANQKYYDKAAAPSDSSTYFWFTLKNLRV |
| Molecular Weight | 10434.456 |
| Grand Average of Hydropathy | -0.404 |
| Isoelectric Point | 8.683 |
| Charge at pH 7.4 | 1.563 |
| Secondary Structure | Helix: 0.281, Turn: 0.260, Sheet: 0.167 |
| Instability Index | 27.921 |
| Aromaticity | 0.115 |
