| ID | DRAMP00277 |
|---|---|
| Sequence | DICTNCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA |
| Length | 47 |
| Name | Potamin-1 (PT-1; Plants) |
| Source | Solanum tuberosum (Potato) |
| Activity | Antimicrobial, Antifungal, Antibacterial, Anti-Gram+ |
| Pathogen | [Ref.15809084]Fungi: Candida albicans(MIC =100μM) and Rhizoctonia solani(MIC =100μM);##Gram-positive bacterium: Clavibacter michiganensis(MIC =50μM) |
| Hemolytic Activity | [Ref:15809084]Non-hemolytic activity against human erythrocytes |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P84813 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15809084 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | DICTNCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA |
| Molecular Weight | 4833.441 |
| Grand Average of Hydropathy | -0.332 |
| Isoelectric Point | 6.698 |
| Charge at pH 7.4 | -0.588 |
| Secondary Structure | Helix: 0.128, Turn: 0.298, Sheet: 0.170 |
| Instability Index | 41.553 |
| Aromaticity | 0.043 |