| ID | DRAMP00315 |
|---|---|
| Sequence | MTPQGNKPSCHDVITNAWRPTATDSAAGRAPGYGVITNIINGGLDC |
| Length | 46 |
| Name | Endochitinase 4 (CHIT 4; Plant defensin) |
| Source | Arachis hypogaea (Peanut) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q06016 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1980004 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | MTPQGNKPSCHDVITNAWRPTATDSAAGRAPGYGVITNIINGGLDC |
| Molecular Weight | 4742.247 |
| Grand Average of Hydropathy | -0.307 |
| Isoelectric Point | 6.496 |
| Charge at pH 7.4 | -0.731 |
| Secondary Structure | Helix: 0.196, Turn: 0.348, Sheet: 0.152 |
| Instability Index | 44.67 |
| Aromaticity | 0.043 |