| ID | DRAMP00392 |
|---|---|
| Sequence | VAKCTEESGGKYFVFCCYKPTRICYMNEQKCESTCIGK |
| Length | 38 |
| Name | Antimicrobial peptide 1 (ToAMP1; Cys-rich; Plant defensin) |
| Source | Taraxacum officinale (Common dandelion) (Leontodon taraxacum) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Fungi: Botrytis cinerea (IC50=5.8 µM), Aspergillus niger (IC50=5.6 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B3EWQ1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22640720 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | VAKCTEESGGKYFVFCCYKPTRICYMNEQKCESTCIGK |
| Molecular Weight | 4349.061 |
| Grand Average of Hydropathy | -0.361 |
| Isoelectric Point | 8.287 |
| Charge at pH 7.4 | 1.361 |
| Secondary Structure | Helix: 0.237, Turn: 0.184, Sheet: 0.158 |
| Instability Index | 55.526 |
| Aromaticity | 0.132 |