| ID | DRAMP00748 |
|---|---|
| Sequence | QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |
| Length | 54 |
| Name | Defensin-like protein(Brazzein; Plants) |
| Source | Pentadiplandra brazzeana |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
| Pathogen | Gram-positive bacteria: Bacillus subtilis, Staphylococcus aureus.##Gram-positive bacterium: Escherichia coli.##Yeast: Candida albicans. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P56552 |
| PDB | 1BRZ ##4HE7 resolved by X-ray. |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15118082, 9628478 |
Physicochemical Properties
| Residues | 54 |
|---|---|
| Sequence | QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |
| Molecular Weight | 6498.278 |
| Grand Average of Hydropathy | -1.106 |
| Isoelectric Point | 6.714 |
| Charge at pH 7.4 | -0.628 |
| Secondary Structure | Helix: 0.241, Turn: 0.148, Sheet: 0.167 |
| Instability Index | 52.178 |
| Aromaticity | 0.13 |