| ID | DRAMP00932 |
|---|---|
| Sequence | SYFSAWAGPGCNNHNARYSKCGCSNIGHNVHGGYEFVYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSNFGWKSVFIQC |
| Length | 79 |
| Name | Antimicrobial peptide 1 (PMAP1; Plant defensin) |
| Source | Pinus monticola (Western white pine) (Strobus monticola) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P83880 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18943919, 14759906 |
Physicochemical Properties
| Residues | 79 |
|---|---|
| Sequence | SYFSAWAGPGCNNHNARYSKCGCSNIGHNVHGGYEFVYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSNFGWKSVFIQC |
| Molecular Weight | 8569.282 |
| Grand Average of Hydropathy | -0.452 |
| Isoelectric Point | 8.604 |
| Charge at pH 7.4 | 2.198 |
| Secondary Structure | Helix: 0.241, Turn: 0.354, Sheet: 0.114 |
| Instability Index | 21.514 |
| Aromaticity | 0.152 |