Basic Information
| ID | DRAMP00933 |
|---|
| Sequence | SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC |
|---|
| Length | 76 |
|---|
| Name | Antimicrobial peptide 1 (AMP1; MiAMP1; Plant defensin) |
|---|
| Source | Macadamia integrifolia (Macadamia nut) |
|---|
| Activity | Antimicrobial, Antibacterial, Antifungal |
|---|
| Pathogen | Alternaria helianthi (MIC=2-5 µg/ml), Botrytis cinerea (MIC=5-10 µg/ml), Ceratocystis parodoxa (MIC=20 µg/ml), Colletotrichum gloeosporioides (MIC=2-5 µg/ml), Fusurium oxysporum (MIC=2-5 µg/ml), Leptosphaeria maculans (MIC=5 µg/ml), Macrophomina phaseolina (MIC<25 µg/ml), Phytophthoru cryptogea (MIC=5-10 µg/ml), Pythium graminicola (MIC=5 µg/ml), Sclerotinia sclerotiorum spores (MIC=5 µg/ml), Sclerotinia sclerotiorum mycelia (MIC=50 µg/ml), Verticilium dahliae (MIC=2 µg/ml), Clavibacter michiganensis (MIC<10 µg/ml), Saccharomyces cerevisiae (MIC=2-5 µg/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization of a C-terminal Cys residue (forming a disulfide bond) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P80915 |
|---|
| PDB |
1C01 |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 9108242, 10543955 |
|---|
