| ID | DRAMP00969 |
|---|---|
| Sequence | KSCCRSTLGRNCYNLCRVRGAQKLCAGVCRCKLTSSGKCPTGFPK |
| Length | 45 |
| Name | Alpha-hordothionin (alpha-HT; Plant defensin) |
| Source | Hordeum vulgare (Barley) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P01545 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 3082629, 2850969 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | KSCCRSTLGRNCYNLCRVRGAQKLCAGVCRCKLTSSGKCPTGFPK |
| Molecular Weight | 4855.786 |
| Grand Average of Hydropathy | -0.318 |
| Isoelectric Point | 9.755 |
| Charge at pH 7.4 | 9.346 |
| Secondary Structure | Helix: 0.178, Turn: 0.289, Sheet: 0.133 |
| Instability Index | 30.409 |
| Aromaticity | 0.044 |