Basic Information
| ID | DRAMP00984 |
|---|
| Sequence | AGECVQGRCPSGMCCSQFGYCGRGPKYCGR |
|---|
| Length | 30 |
|---|
| Name | Antimicrobial peptide Ar-AMP (Ar-AMP; hevin-like peptides; Plant defensin) |
|---|
| Source | Amaranthus retroflexus (Redroot amaranth) (Redroot pigweed) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
|---|
| Pathogen | Fungi: Botrytis cinerea, Fusarium culmorum, Helminthosporium sativum and Alternaria consortiale.##Gram-positive bacterium: Bacillus subtilis. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q5I2B2 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 16126239 |
|---|
