| ID | DRAMP01039 |
|---|---|
| Sequence | RQRDPQQQYEQCQKHCQRRETEPRHMQTCQQRCERRYEKEKRKQQKR |
| Length | 47 |
| Name | Vicilin-like Antimicrobial peptide 2c-2 (MiAMP2c-2; Plant defensin) |
| Source | Macadamia integrifolia (Macadamia nut) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
| Pathogen | Gram-positive bacteria: (- Ca2+, + Ca2+): Clavibacter michiganensis (IC50=50, >50 µg/ml);##Fungi (- Ca2+, + Ca2+): Alternaria helianthi (IC50=5-10, ND µg/ml), Ceratocystis paradoxa (IC50=20-50, >50 µg/ml), Cercospora nicotianae (IC50=5-10, 5-10 µg/ml), Chalara elegans (IC50=2-5, 10-20 µg/ml), Fusarium oxysporum (IC50=10, 20-50 µg/ml), Leptosphaeria maculans (IC50=25, >50 µg/ml), Sclerotinia sclerotiorum (IC50=20-50, >50 µg/ml), Verticillium dahliae (IC50=5-10, >50 µg/ml), Saccharomyces cerevisiae (IC50=20-50, >50 µg/ml), Phytophthora cryptogea (IC50=5-10, 10-25 µg/ml), Phytophthora parasitica nicotianae (IC50=10-20, >50 µg/ml).##[NOTE:, Ca2+ = Medium with low content of CaCl2 (50 µM); + Ca2+ = Medium supplemented with high concentration of CaCl2 (1 mM)] |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9SPL5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10571855 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | RQRDPQQQYEQCQKHCQRRETEPRHMQTCQQRCERRYEKEKRKQQKR |
| Molecular Weight | 6188.886 |
| Grand Average of Hydropathy | -2.823 |
| Isoelectric Point | 9.954 |
| Charge at pH 7.4 | 7.522 |
| Secondary Structure | Helix: 0.043, Turn: 0.043, Sheet: 0.149 |
| Instability Index | 78 |
| Aromaticity | 0.043 |
