| ID | DRAMP01054 |
|---|---|
| Sequence | QNICPRVNRIVTPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVNRNPGLRRNPRFQNIPRDCRNTFVRPFWWRPRIQCGRINLTDKLIYL |
| Length | 101 |
| Name | Antimicrobial protein Ace-AMP1 (Ace-AMP1; Plant defensin) |
| Source | Allium cepa (onion) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
| Pathogen | Gram-positive bacteria: Bacillus megaterium, Sarcina Lutea.##Fungi (SMF-, SMF+): Alternaria brassicola (IC50=2.5, 1.5 µg/ml), Ascockyta pisi (IC50=1, 10 µg/ml), Botrytis cinerea (IC50=3, 7 µg/ml), Colletotrickum lindemutkianum (IC50=1.5, 1.5 µg/ml), Fusarium culmorum (IC50=6, 10 µg/ml), Fusarium oxysporum fsp. pisi (IC50=3.5, 4 µg/ml), Fusarium oxysporum fsp. lycopersici (IC50=3, 10 µg/ml),Nectria haematococca (IC50=3.5, 7 µg/ml),Phoma betae (IC50=1.5, 7 µg/ml), Pyrenopkora tritici-repentis (IC50=3, 3.5 µg/ml), Pyricularia oryzae (IC50=3, 7 µg/ml), Verticillium dahliae (IC50=0.25, 0.5 µg/ml).##[NOTE: SMF- = Synthetic growth Medium with low ionic strength; SMF+ = Synthetic growth Medium supplemented with with 1 mM CaCl2, 50 mM KC1] |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q41258 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7480341, 9521681 |
Physicochemical Properties
| Residues | 101 |
|---|---|
| Sequence | QNICPRVNRIVTPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVNRNPGLRRNPRFQNIPRDCRNTFVRPFWWRPRIQCGRINLTDKLIYL |
| Molecular Weight | 11804.845 |
| Grand Average of Hydropathy | -0.309 |
| Isoelectric Point | 11.565 |
| Charge at pH 7.4 | 16.355 |
| Secondary Structure | Helix: 0.317, Turn: 0.248, Sheet: 0.149 |
| Instability Index | 45.921 |
| Aromaticity | 0.079 |