| ID | DRAMP01296 |
|---|---|
| Sequence | ASKCGRHGDSCVSSSDCCPGTWCHTYANRCQVRITEEELMKQREKILGRKGKDY |
| Length | 54 |
| Name | Omega-conotoxin-like protein 1 (OCLP1) |
| Source | Apis mellifera (Honeybee) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | H9KQJ7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17433819, 22442369 |
Physicochemical Properties
| Residues | 54 |
|---|---|
| Sequence | ASKCGRHGDSCVSSSDCCPGTWCHTYANRCQVRITEEELMKQREKILGRKGKDY |
| Molecular Weight | 6122.891 |
| Grand Average of Hydropathy | -0.946 |
| Isoelectric Point | 8.632 |
| Charge at pH 7.4 | 2.522 |
| Secondary Structure | Helix: 0.167, Turn: 0.222, Sheet: 0.167 |
| Instability Index | 51.115 |
| Aromaticity | 0.056 |