Basic Information
| ID | DRAMP02144 |
|---|
| Sequence | MPVAVGPYGQSQPSCFDRVKMGFMMGFAVGMAAGALFGTFSCLRFGMRGRELMGGVGKTMMQSGGTFGTFMAIGMGIRC |
|---|
| Length | 79 |
|---|
| Name | Reactive oxygen species modulator 1 (ROS modulator 1; Frogs, amphibians, animals) |
|---|
| Source | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | S. aureus, Pseudomonas aeruginosa and M. tuberculosis. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
A4QNF3 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | PubMed ID is not available |
|---|
