| ID | DRAMP02267 |
|---|---|
| Sequence | LKCVNLQANGIKMTQECAKEDTKCLTLRSLKKTLKFCASGRTCTTMKIMSLPGEQITCCEGNMCNA |
| Length | 66 |
| Name | Antimicrobial amphipathic helix-forming peptide (Frogs, amphibians, animals) |
| Source | Xenopus laevis (African clawed frog) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8203742 |
Physicochemical Properties
| Residues | 66 |
|---|---|
| Sequence | LKCVNLQANGIKMTQECAKEDTKCLTLRSLKKTLKFCASGRTCTTMKIMSLPGEQITCCEGNMCNA |
| Molecular Weight | 7235.61 |
| Grand Average of Hydropathy | -0.174 |
| Isoelectric Point | 8.884 |
| Charge at pH 7.4 | 4.346 |
| Secondary Structure | Helix: 0.182, Turn: 0.182, Sheet: 0.288 |
| Instability Index | 44.726 |
| Aromaticity | 0.015 |