Basic Information
| ID | DRAMP02369 |
|---|
| Sequence | LLAWCLVFLVIVQQVTSSPVPQSDTPLTSVQEVQRSLKRTARMTPLWRIMGTKPHGAYCQNHYECSTGICRKGHCSYS |
|---|
| Length | 78 |
|---|
| Name | Liver-expressed antimicrobial peptide 2 (fish, chordates, animals) |
|---|
| Source | Ctenopharyngodon idella (Grass carp) (Leuciscus idella) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli XC-1 and Aeromonas hydrophila S2. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
D0Q093 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 19716607 |
|---|
