| ID | DRAMP02406 |
|---|---|
| Sequence | QEGCEWESRPCNRGCWLPRQWESVHMRFGVLVLWRAPQFEHFRECCNELRCEALRCMMRMRMEYWPRGLQDQQVYQRARDLEPRKHCGMSYPVECRMPR |
| Length | 99 |
| Name | Antimicrobial protein 2 (Si-AMP2; Plants) |
| Source | Sesamum indicum (Oriental sesame) (Sesamum orientale) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B3EWE9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21691771 |
Physicochemical Properties
| Residues | 99 |
|---|---|
| Sequence | QEGCEWESRPCNRGCWLPRQWESVHMRFGVLVLWRAPQFEHFRECCNELRCEALRCMMRMRMEYWPRGLQDQQVYQRARDLEPRKHCGMSYPVECRMPR |
| Molecular Weight | 12268.15 |
| Grand Average of Hydropathy | -0.902 |
| Isoelectric Point | 8.673 |
| Charge at pH 7.4 | 3.45 |
| Secondary Structure | Helix: 0.232, Turn: 0.172, Sheet: 0.283 |
| Instability Index | 55.938 |
| Aromaticity | 0.111 |