Basic Information
| ID | DRAMP02410 |
|---|
| Sequence | FSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA |
|---|
| Length | 62 |
|---|
| Name | Antimicrobial peptide lumbricin-1 |
|---|
| Source | Lumbricus rubellus (Humus earthworm) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | [Ref.9784609]Gram-positive bacteria: Bacillus subtilis ATCC 62037 (MIC=12 µg/ml), Staphylococcus aureus ATCC 15752 (MIC=16 µg/ml), Streptococcus mutans ATCC 25175 (MIC=30 µg/ml);##Gram-negative bacteria: Escherichia coli ATCC 27325 (MIC=12 µg/ml), Pseudomonas putidaATCC 17426 (MIC=16 µg/ml), Serratia sp. ATCC 21074 (MIC=16 µg/ml);##Fungi: Candida albicans ATCC 10231 (MIC=16 µg/ml), Cryptococcus neoformance ATCC 34881 (MIC=25 µg/ml), Saccharomyces cerevisiae ATCC 44774 (MIC=12 µg/ml).##NOTE: Minimal inhibitory concentrations were determined by incubating approximately 104–105 CFU/ml of cells with serial dilutions of each peptide in a 96-well microtiter plate. |
|---|
| Hemolytic Activity | [Ref.9784609]0.02% hemolytic activity at 5 μg/ml, 0.06% hemolytic activity at 10 μg/ml, 0.14% hemolytic activity at 25 μg/ml, 0.19% hemolytic activity at 50 μg/ml, 0.23% hemolytic activity at 100 μg/ml against human erythrocytes |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
O96447 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 9784609 |
|---|
