| ID | DRAMP02440 |
|---|---|
| Sequence | MKRNQKEWESVSKKGLMKPGGTSIVKAAGCMGCWASKSIAMTRVCALPHPAMRAI |
| Length | 55 |
| Name | Sporulation-killing factor SkfA |
| Source | Bacillus subtilis (strain 168) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O31422 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12817086, 15812018, 16816204 |
Physicochemical Properties
| Residues | 55 |
|---|---|
| Sequence | MKRNQKEWESVSKKGLMKPGGTSIVKAAGCMGCWASKSIAMTRVCALPHPAMRAI |
| Molecular Weight | 5934.129 |
| Grand Average of Hydropathy | -0.158 |
| Isoelectric Point | 10.163 |
| Charge at pH 7.4 | 7.233 |
| Secondary Structure | Helix: 0.182, Turn: 0.255, Sheet: 0.291 |
| Instability Index | 25.191 |
| Aromaticity | 0.036 |