| ID | DRAMP02464 |
|---|---|
| Sequence | GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP |
| Length | 60 |
| Name | L-amino-acid oxidase (LAAO, LAO; reptilia, animals) |
| Source | Bitis gabonica (Gaboon adder) (Gaboon viper) |
| Activity | Antimicrobial, Antibacterial, Antiparasitic |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q6T627 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15276202 |
Physicochemical Properties
| Residues | 60 |
|---|---|
| Sequence | GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP |
| Molecular Weight | 7322.542 |
| Grand Average of Hydropathy | -0.9 |
| Isoelectric Point | 9.928 |
| Charge at pH 7.4 | 6.605 |
| Secondary Structure | Helix: 0.350, Turn: 0.183, Sheet: 0.200 |
| Instability Index | 28.36 |
| Aromaticity | 0.117 |
