| ID | DRAMP02469 |
|---|---|
| Sequence | VNVLGGIEYSINNATLCSVGFSVRVFNYAEGAVRGLTQGNACMGRGDSGGSWFTLFERQYGL |
| Length | 62 |
| Name | Alpha-lytic protease L1 |
| Source | Lysobacter sp. (strain XL1) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P85142 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 62 |
|---|---|
| Sequence | VNVLGGIEYSINNATLCSVGFSVRVFNYAEGAVRGLTQGNACMGRGDSGGSWFTLFERQYGL |
| Molecular Weight | 6611.329 |
| Grand Average of Hydropathy | 0.108 |
| Isoelectric Point | 6.214 |
| Charge at pH 7.4 | -0.53 |
| Secondary Structure | Helix: 0.339, Turn: 0.339, Sheet: 0.210 |
| Instability Index | 31.266 |
| Aromaticity | 0.129 |