| ID | DRAMP02572 |
|---|---|
| Sequence | YRGGYTGPIPRPPPIGRPPLRPVCNACYRLSVSDARNCCIKFGSCCHLVK |
| Length | 50 |
| Name | Penaeidin-2b (Pen-2b; shrimps, Arthropods, animals) |
| Source | Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q963C4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12242595 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | YRGGYTGPIPRPPPIGRPPLRPVCNACYRLSVSDARNCCIKFGSCCHLVK |
| Molecular Weight | 5490.465 |
| Grand Average of Hydropathy | -0.228 |
| Isoelectric Point | 9.55 |
| Charge at pH 7.4 | 6.435 |
| Secondary Structure | Helix: 0.260, Turn: 0.360, Sheet: 0.100 |
| Instability Index | 48.89 |
| Aromaticity | 0.08 |