| ID | DRAMP02687 |
|---|---|
| Sequence | GPNVYIQKIFASCWRLQGTCRPKCLKNETISYFGVILYICGCVNPKYLPILTGK |
| Length | 54 |
| Name | Beta-defensin 135 (Defensin, beta 135; primates, mammals, animals) |
| Source | Pan troglodytes (Chimpanzee) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KJ4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 54 |
|---|---|
| Sequence | GPNVYIQKIFASCWRLQGTCRPKCLKNETISYFGVILYICGCVNPKYLPILTGK |
| Molecular Weight | 6112.281 |
| Grand Average of Hydropathy | 0.2 |
| Isoelectric Point | 9.333 |
| Charge at pH 7.4 | 5.413 |
| Secondary Structure | Helix: 0.389, Turn: 0.259, Sheet: 0.130 |
| Instability Index | 32.92 |
| Aromaticity | 0.13 |