| ID | DRAMP02697 |
|---|---|
| Sequence | ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRIGHCTILESLSGVCEISGRLYRLCCR |
| Length | 75 |
| Name | Defensin-5 (Defensin, alpha 5; primates, mammals, animals) |
| Source | Pan troglodytes (Chimpanzee) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q5G861 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15494476 |
Physicochemical Properties
| Residues | 75 |
|---|---|
| Sequence | ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRIGHCTILESLSGVCEISGRLYRLCCR |
| Molecular Weight | 8100.944 |
| Grand Average of Hydropathy | -0.369 |
| Isoelectric Point | 5.725 |
| Charge at pH 7.4 | -1.444 |
| Secondary Structure | Helix: 0.213, Turn: 0.240, Sheet: 0.280 |
| Instability Index | 41.144 |
| Aromaticity | 0.04 |