Basic Information
| ID | DRAMP02792 |
|---|
| Sequence | ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS |
|---|
| Length | 36 |
|---|
| Name | Scarabaecin, major form (Insects, animals) |
|---|
| Source | Oryctes rhinoceros (Coconut rhinoceros beetle) |
|---|
| Activity | Antimicrobial, Antibacterial, Antifungal |
|---|
| Pathogen | Fungi: P. oryzae (IC50=16 µM), R. solani (IC50=32 µM), Botrytis cinerea (IC50=4 µM), S.tritici (IC50=16 µM), P. syringae pv.mori S6804 (IC50=25 µM); And Staphylococcus aureus, B. bassiana (weak activity). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q86SC0 |
|---|
| PDB |
1IYC |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 12859949, 12676931 |
|---|
