| ID | DRAMP02799 |
|---|---|
| Sequence | DVQCGEGHFCHDQTCCRASQGGACCPYSQGVCCADQRHCCPVGF |
| Length | 44 |
| Name | Antimicrobial peptide eNAP-1 (houses, mammals, animals) |
| Source | Equus caballus (Horse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Streptococcus zooepidemicus, Escherichia coli, Pseudomonas aeruginosa, Klebsiella pneumoniae |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80930 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1639474 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | DVQCGEGHFCHDQTCCRASQGGACCPYSQGVCCADQRHCCPVGF |
| Molecular Weight | 4668.2 |
| Grand Average of Hydropathy | -0.243 |
| Isoelectric Point | 5.738 |
| Charge at pH 7.4 | -2.578 |
| Secondary Structure | Helix: 0.136, Turn: 0.227, Sheet: 0.091 |
| Instability Index | 44.664 |
| Aromaticity | 0.068 |