| ID | DRAMP02800 |
|---|---|
| Sequence | EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN |
| Length | 46 |
| Name | Antimicrobial peptide eNAP-2 (houses, mammals, animals) |
| Source | Equus caballus (Horse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Streptococcus zooepidemicus, Escherichia coli, Pseudomonas aeruginosa. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P56928 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1452336, 8514405 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN |
| Molecular Weight | 4769.387 |
| Grand Average of Hydropathy | -0.698 |
| Isoelectric Point | 8.361 |
| Charge at pH 7.4 | 1.589 |
| Secondary Structure | Helix: 0.109, Turn: 0.370, Sheet: 0.152 |
| Instability Index | 59.12 |
| Aromaticity | 0.022 |