| ID | DRAMP02810 |
|---|---|
| Sequence | QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR |
| Length | 43 |
| Name | Myticin C |
| Source | Mytilus galloprovincialis (Mediterranean mussel) |
| Activity | Antimicrobial, Antibacterial, Antifungal, Antiviral |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17628673 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR |
| Molecular Weight | 4705.42 |
| Grand Average of Hydropathy | 0.179 |
| Isoelectric Point | 8.191 |
| Charge at pH 7.4 | 1.418 |
| Secondary Structure | Helix: 0.279, Turn: 0.256, Sheet: 0.186 |
| Instability Index | 47.5 |
| Aromaticity | 0.14 |