| ID | DRAMP02821 |
|---|---|
| Sequence | SLQPGAPSFPMPGSQLPTSVSGNVEKQGRNTIATIDAQHKTDRYDVRGTWTKVVDGPGRSKPNFRIGGSYRW |
| Length | 72 |
| Name | Holotricin-2 (Gly-rich; His-rich; invertebrate defensin; animals) |
| Source | Holotrichia diomphalia (Korean black chafer) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q25054 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8188641 |
Physicochemical Properties
| Residues | 72 |
|---|---|
| Sequence | SLQPGAPSFPMPGSQLPTSVSGNVEKQGRNTIATIDAQHKTDRYDVRGTWTKVVDGPGRSKPNFRIGGSYRW |
| Molecular Weight | 7857.665 |
| Grand Average of Hydropathy | -0.858 |
| Isoelectric Point | 10.266 |
| Charge at pH 7.4 | 4.278 |
| Secondary Structure | Helix: 0.222, Turn: 0.361, Sheet: 0.097 |
| Instability Index | 41.926 |
| Aromaticity | 0.083 |