Basic Information
| ID | DRAMP02841 |
| Sequence | RQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIK |
| Length | 34 |
| Name | Lumbricin I(6–34) |
| Source | Synthetic construct (derived from residues 6–34 of lumbricin I) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
| Pathogen | [Ref.9784609]Gram-positive bacteria: Bacillus subtilis ATCC 62037 (MIC=8 µg/ml), Staphylococcus aureus ATCC 15752 (MIC=12 µg/ml), Streptococcus mutans ATCC 25175 (MIC=20 µg/ml);##Gram-negative bacteria: Escherichia coli ATCC 27325 (MIC=8 µg/ml), Pseudomonas putidaATCC 17426 (MIC=12 µg/ml), Serratia sp. ATCC 21074 (MIC=12 µg/ml).##Fungi: Candida albicans ATCC 10231 (MIC=12 µg/ml), Cryptococcus neoformance ATCC 34881 (MIC=16 µg/ml), Saccharomyces cerevisiae ATCC 44774 (MIC=8 µg/ml).##NOTE: Minimal inhibitory concentrations were determined by incubating approximately 104–105 CFU/ml of cells with serial dilutions of each peptide in a 96-well microtiter plate.. |
| Hemolytic Activity | [Ref.9784609]0.03% hemolytic activity at 5 μg/ml, 0.07% hemolytic activity at 10 μg/ml, 0.13% hemolytic activity at 25 μg/ml, 0.17% hemolytic activity at 50 μg/ml, 0.21% hemolytic activity at 100 μg/ml against human erythrocytes |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot |
O96447 |
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 9784609 |
|---|