Basic Information
| ID | DRAMP02875 |
|---|
| Sequence | LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETLRGDERILSILRHQNLLKELQDLALQGAKERTHQQ |
|---|
| Length | 76 |
|---|
| Name | Vasostatin-1 (VS-1; N-terminal fragment of Chromogranin-A; mammals, animals) |
|---|
| Source | Bos taurus (Bovine) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
|---|
| Pathogen | Gram-positive bacteria: Micrococcus luteus (MIC=2 µM), Bacillus megaterium (MIC=0.2 µM).##Fungi: Neurospora crassa (MIC=3 µM), Aspergillus fumigatus (MIC=5 µM), Alternaria brassicicola (MIC=3 µM), Nectria haematococca (MIC=1 µM), Fusarium culmorum (MIC=1 µM), F. oxyporum (MIC=10 µM), Saccharomyces cerevisiae (MIC=10 µM), Candida albicans (MIC=10 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P05059, P79392, Q2KJ52 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10753865 |
|---|
