| ID | DRAMP02927 |
|---|---|
| Sequence | NKDCKYWCKDNLGLNYCCGQPGVTYPPFTKKHLGRCPAVRDTCTGVRTQLPTYCPHDGACQFRSKCCYDTCLKHHVCKTAEYPY |
| Length | 84 |
| Name | Antibacterial 11.5 kDa protein (crabs, Arthropods, animals) |
| Source | Carcinus maenas (Common shore crab) (Green crab) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9Y099 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16712935 |
Physicochemical Properties
| Residues | 84 |
|---|---|
| Sequence | NKDCKYWCKDNLGLNYCCGQPGVTYPPFTKKHLGRCPAVRDTCTGVRTQLPTYCPHDGACQFRSKCCYDTCLKHHVCKTAEYPY |
| Molecular Weight | 9601.993 |
| Grand Average of Hydropathy | -0.681 |
| Isoelectric Point | 8.743 |
| Charge at pH 7.4 | 5.376 |
| Secondary Structure | Helix: 0.226, Turn: 0.202, Sheet: 0.107 |
| Instability Index | 39.594 |
| Aromaticity | 0.119 |