Basic Information
| ID | DRAMP02936 |
|---|
| Sequence | NPLIPAIYIGATVGPSVWAYLVALVGAAAVTAANIRRASSDNHSCAGNRGWCRSKCFRHEYVDTYYSAVCGRYFCCRSR |
|---|
| Length | 79 |
|---|
| Name | Big defensin (crabs, Arthropods, animals) |
|---|
| Source | Tachypleus tridentatus (Japanese horseshoe crab) |
|---|
| Activity | Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli 09:K39 (IC50=5 µg/ml), Salmonella typhimurium LT2 (IC50=20 µg/ml), S. minnesota R595 (IC50=1.3 µg/ml), Klebsiella pneumoniae (IC50>10 µg/ml);##Gram-positive bacteria: Staphylococcus aureus (IC50<2.5 µg/ml).##Yeast: Candida albicans (IC50>20 µg/ml)(Ref.1).##Note: Washed with a phosphate buffered saline (PBS, pH 7.0). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P80957 |
|---|
| PDB |
2RNG |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 8586631, 18785751 |
|---|
