| ID | DRAMP02946 |
|---|---|
| Sequence | YEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRCKYCVVF |
| Length | 65 |
| Name | PtALF1 (Portunus trituberculatus anti-lipopolysaccharide factor isoform 1; crabs, Arthropods, ani |
| Source | Portunus trituberculatus (Swimming Crab) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21168510 |
Physicochemical Properties
| Residues | 65 |
|---|---|
| Sequence | YEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRCKYCVVF |
| Molecular Weight | 7831.118 |
| Grand Average of Hydropathy | -0.209 |
| Isoelectric Point | 9.462 |
| Charge at pH 7.4 | 5.551 |
| Secondary Structure | Helix: 0.385, Turn: 0.185, Sheet: 0.169 |
| Instability Index | 55.988 |
| Aromaticity | 0.2 |