| ID | DRAMP02949 |
|---|---|
| Sequence | GWLDIVKAIVVPAARETIKTQEITLLDHYCTLSRSPYIKSLELHYRAEVTCPGWTIIRGRGSNHRNPTNSGKDALKDFMTQAVAAGLVTKEEAAPWLN |
| Length | 98 |
| Name | PtALF4 (Portunus trituberculatus anti-lipopolysaccharide factor isoform 4; crabs, Arthropods, ani |
| Source | Portunus trituberculatus (Swimming Crab) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21362485, 22333564 |
Physicochemical Properties
| Residues | 98 |
|---|---|
| Sequence | GWLDIVKAIVVPAARETIKTQEITLLDHYCTLSRSPYIKSLELHYRAEVTCPGWTIIRGRGSNHRNPTNSGKDALKDFMTQAVAAGLVTKEEAAPWLN |
| Molecular Weight | 10905.38 |
| Grand Average of Hydropathy | -0.252 |
| Isoelectric Point | 8.683 |
| Charge at pH 7.4 | 1.604 |
| Secondary Structure | Helix: 0.296, Turn: 0.204, Sheet: 0.265 |
| Instability Index | 37.599 |
| Aromaticity | 0.071 |
