| ID | DRAMP02954 |
|---|---|
| Sequence | SRWPSPGRPRPFPGRPNPIFRPRPCICVRQPCPCDTY |
| Length | 37 |
| Name | Arasin 2 (Pro-rich, Arg-rich; crabs, Arthropods, animals) |
| Source | Hyas araneus (Great spider crab) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | A6XMY1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17658600 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | SRWPSPGRPRPFPGRPNPIFRPRPCICVRQPCPCDTY |
| Molecular Weight | 4308.011 |
| Grand Average of Hydropathy | -0.976 |
| Isoelectric Point | 10.626 |
| Charge at pH 7.4 | 5.153 |
| Secondary Structure | Helix: 0.189, Turn: 0.432, Sheet: 0.000 |
| Instability Index | 87.689 |
| Aromaticity | 0.108 |