| ID | DRAMP02966 |
|---|---|
| Sequence | KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI |
| Length | 55 |
| Name | DBI(32-86) (pigs, mammals, animals) |
| Source | Sus scrofa (Pig) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacteria: Bacillus megaterium Bm11 (MIC=0.69 µM);##Gram-negative bacteria: Escherichia coli D22 (MIC=30 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P12026, A7YB23, Q9TSG2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8375398, 3289918 |
Physicochemical Properties
| Residues | 55 |
|---|---|
| Sequence | KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI |
| Molecular Weight | 6150.025 |
| Grand Average of Hydropathy | -0.876 |
| Isoelectric Point | 9.479 |
| Charge at pH 7.4 | 3.531 |
| Secondary Structure | Helix: 0.255, Turn: 0.200, Sheet: 0.255 |
| Instability Index | 17.8 |
| Aromaticity | 0.073 |